Anti GGPS1 pAb (ATL-HPA029472 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029472-100
  • Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: geranylgeranyl diphosphate synthase 1
Gene Name: GGPS1
Alternative Gene Name: GGPPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021302: 91%, ENSRNOG00000016767: 92%
Entrez Gene ID: 9453
Uniprot ID: O95749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKE
Gene Sequence CEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKE
Gene ID - Mouse ENSMUSG00000021302
Gene ID - Rat ENSRNOG00000016767
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GGPS1 pAb (ATL-HPA029472 w/enhanced validation)
Datasheet Anti GGPS1 pAb (ATL-HPA029472 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GGPS1 pAb (ATL-HPA029472 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GGPS1 pAb (ATL-HPA029472 w/enhanced validation)
Datasheet Anti GGPS1 pAb (ATL-HPA029472 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GGPS1 pAb (ATL-HPA029472 w/enhanced validation)