Anti GGNBP2 pAb (ATL-HPA073392)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073392-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GGNBP2
Alternative Gene Name: DIF-3, DIF3, FLJ21230, FLJ22561, LZK1, ZFP403, ZNF403
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020530: 99%, ENSRNOG00000027860: 99%
Entrez Gene ID: 79893
Uniprot ID: Q9H3C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DGEEEFPFERRQIPLYIDDTLTMVMEFPDNVLNLDGHQNNGAQLKQFIQRHGMLKQQDLSIAMVVTSREVLSALSQLVPCVGCRRSVERLFSQLV |
| Gene Sequence | DGEEEFPFERRQIPLYIDDTLTMVMEFPDNVLNLDGHQNNGAQLKQFIQRHGMLKQQDLSIAMVVTSREVLSALSQLVPCVGCRRSVERLFSQLV |
| Gene ID - Mouse | ENSMUSG00000020530 |
| Gene ID - Rat | ENSRNOG00000027860 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GGNBP2 pAb (ATL-HPA073392) | |
| Datasheet | Anti GGNBP2 pAb (ATL-HPA073392) Datasheet (External Link) |
| Vendor Page | Anti GGNBP2 pAb (ATL-HPA073392) at Atlas Antibodies |
| Documents & Links for Anti GGNBP2 pAb (ATL-HPA073392) | |
| Datasheet | Anti GGNBP2 pAb (ATL-HPA073392) Datasheet (External Link) |
| Vendor Page | Anti GGNBP2 pAb (ATL-HPA073392) |