Anti GGNBP2 pAb (ATL-HPA073392)

Atlas Antibodies

Catalog No.:
ATL-HPA073392-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: gametogenetin binding protein 2
Gene Name: GGNBP2
Alternative Gene Name: DIF-3, DIF3, FLJ21230, FLJ22561, LZK1, ZFP403, ZNF403
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020530: 99%, ENSRNOG00000027860: 99%
Entrez Gene ID: 79893
Uniprot ID: Q9H3C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGEEEFPFERRQIPLYIDDTLTMVMEFPDNVLNLDGHQNNGAQLKQFIQRHGMLKQQDLSIAMVVTSREVLSALSQLVPCVGCRRSVERLFSQLV
Gene Sequence DGEEEFPFERRQIPLYIDDTLTMVMEFPDNVLNLDGHQNNGAQLKQFIQRHGMLKQQDLSIAMVVTSREVLSALSQLVPCVGCRRSVERLFSQLV
Gene ID - Mouse ENSMUSG00000020530
Gene ID - Rat ENSRNOG00000027860
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GGNBP2 pAb (ATL-HPA073392)
Datasheet Anti GGNBP2 pAb (ATL-HPA073392) Datasheet (External Link)
Vendor Page Anti GGNBP2 pAb (ATL-HPA073392) at Atlas Antibodies

Documents & Links for Anti GGNBP2 pAb (ATL-HPA073392)
Datasheet Anti GGNBP2 pAb (ATL-HPA073392) Datasheet (External Link)
Vendor Page Anti GGNBP2 pAb (ATL-HPA073392)