Anti GGH pAb (ATL-HPA025226)

Atlas Antibodies

Catalog No.:
ATL-HPA025226-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)
Gene Name: GGH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073987: 77%, ENSRNOG00000007351: 73%
Entrez Gene ID: 8836
Uniprot ID: Q92820
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK
Gene Sequence FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK
Gene ID - Mouse ENSMUSG00000073987
Gene ID - Rat ENSRNOG00000007351
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GGH pAb (ATL-HPA025226)
Datasheet Anti GGH pAb (ATL-HPA025226) Datasheet (External Link)
Vendor Page Anti GGH pAb (ATL-HPA025226) at Atlas Antibodies

Documents & Links for Anti GGH pAb (ATL-HPA025226)
Datasheet Anti GGH pAb (ATL-HPA025226) Datasheet (External Link)
Vendor Page Anti GGH pAb (ATL-HPA025226)
Citations for Anti GGH pAb (ATL-HPA025226) – 3 Found
Melling, Nathaniel; Rashed, Masoud; Schroeder, Cornelia; Hube-Magg, Claudia; Kluth, Martina; Lang, Dagmar; Simon, Ronald; Möller-Koop, Christina; Steurer, Stefan; Sauter, Guido; Jacobsen, Frank; Büscheck, Franziska; Wittmer, Corinna; Clauditz, Till; Krech, Till; Tsourlakis, Maria Christina; Minner, Sarah; Huland, Hartwig; Graefen, Markus; Budäus, Lars; Thederan, Imke; Salomon, Georg; Schlomm, Thorsten; Wilczak, Waldemar. High-Level γ-Glutamyl-Hydrolase (GGH) Expression is Linked to Poor Prognosis in ERG Negative Prostate Cancer. International Journal Of Molecular Sciences. 2017;18(2)  PubMed
Bertolo, Alessandro; Baur, Martin; Guerrero, Julien; Pötzel, Tobias; Stoyanov, Jivko. Autofluorescence is a Reliable in vitro Marker of Cellular Senescence in Human Mesenchymal Stromal Cells. Scientific Reports. 2019;9(1):2074.  PubMed
Shubbar, Emman; Helou, Khalil; Kovács, Anikó; Nemes, Szilárd; Hajizadeh, Shahin; Enerbäck, Charlotta; Einbeigi, Zakaria. High levels of γ-glutamyl hydrolase (GGH) are associated with poor prognosis and unfavorable clinical outcomes in invasive breast cancer. Bmc Cancer. 2013;13( 23374458):47.  PubMed