Anti GGCT pAb (ATL-HPA029914)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029914-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GGCT
Alternative Gene Name: C7orf24, CRF21, GCTG, Ggc, MGC3077
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002797: 80%, ENSRNOG00000034084: 83%
Entrez Gene ID: 79017
Uniprot ID: O75223
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDE |
| Gene Sequence | NSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDE |
| Gene ID - Mouse | ENSMUSG00000002797 |
| Gene ID - Rat | ENSRNOG00000034084 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GGCT pAb (ATL-HPA029914) | |
| Datasheet | Anti GGCT pAb (ATL-HPA029914) Datasheet (External Link) |
| Vendor Page | Anti GGCT pAb (ATL-HPA029914) at Atlas Antibodies |
| Documents & Links for Anti GGCT pAb (ATL-HPA029914) | |
| Datasheet | Anti GGCT pAb (ATL-HPA029914) Datasheet (External Link) |
| Vendor Page | Anti GGCT pAb (ATL-HPA029914) |
| Citations for Anti GGCT pAb (ATL-HPA029914) – 2 Found |
| Gromov, Pavel; Gromova, Irina; Friis, Esbern; Timmermans-Wielenga, Vera; Rank, Fritz; Simon, Ronald; Sauter, Guido; Moreira, José M A. Proteomic profiling of mammary carcinomas identifies C7orf24, a gamma-glutamyl cyclotransferase, as a potential cancer biomarker. Journal Of Proteome Research. 2010;9(8):3941-53. PubMed |
| Amano, Tomonari; Eishi, Yoshinobu; Yamada, Tetsuo; Uchida, Keisuke; Minegishi, Kana; Tamura, Tomoki; Kobayashi, Daisuke; Hiroshi, Kawachi; Suzuki, Takashige; Board, Philip G. Widespread expression of γ-glutamyl cyclotransferase suggests it is not a general tumor marker. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2012;60(1):76-86. PubMed |