Anti GGCT pAb (ATL-HPA020735 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020735-25

• 
• 

Protein Description: gamma-glutamylcyclotransferase
Gene Name: GGCT
Alternative Gene Name: C7orf24, CRF21, GCTG, Ggc, MGC3077
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002797: 86%, ENSRNOG00000034084: 84%
Entrez Gene ID: 79017
Uniprot ID: O75223
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIE
• Gene Sequence: QEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIE
• Gene ID - Mouse: ENSMUSG00000002797
• Gene ID - Rat: ENSRNOG00000034084
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GGCT pAb (ATL-HPA020735 w/enhanced validation) – 2 Found

Amano, Tomonari; Eishi, Yoshinobu; Yamada, Tetsuo; Uchida, Keisuke; Minegishi, Kana; Tamura, Tomoki; Kobayashi, Daisuke; Hiroshi, Kawachi; Suzuki, Takashige; Board, Philip G. Widespread expression of γ-glutamyl cyclotransferase suggests it is not a general tumor marker. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2012;60(1):76-86. 

Zhang, Wenjie; Chen, Lei; Xiang, Honggang; Hu, Chunhua; Shi, Weibin; Dong, Ping; Lv, Wenjie. Knockdown of GGCT inhibits cell proliferation and induces late apoptosis in human gastric cancer. Bmc Biochemistry. 2016;17(1):19.