Anti GGA2 pAb (ATL-HPA063634)

Atlas Antibodies

Catalog No.:
ATL-HPA063634-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: golgi-associated, gamma adaptin ear containing, ARF binding protein 2
Gene Name: GGA2
Alternative Gene Name: KIAA1080, VEAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030872: 73%, ENSRNOG00000053118: 75%
Entrez Gene ID: 23062
Uniprot ID: Q9UJY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NCCEEKRNPSSSTLPGGGVQNPSADRNLLDLLSPQPAPCPLNYVSQKSVPKEVPPGTKSSPGWSWEAGPLAPSPSSQNTP
Gene Sequence NCCEEKRNPSSSTLPGGGVQNPSADRNLLDLLSPQPAPCPLNYVSQKSVPKEVPPGTKSSPGWSWEAGPLAPSPSSQNTP
Gene ID - Mouse ENSMUSG00000030872
Gene ID - Rat ENSRNOG00000053118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GGA2 pAb (ATL-HPA063634)
Datasheet Anti GGA2 pAb (ATL-HPA063634) Datasheet (External Link)
Vendor Page Anti GGA2 pAb (ATL-HPA063634) at Atlas Antibodies

Documents & Links for Anti GGA2 pAb (ATL-HPA063634)
Datasheet Anti GGA2 pAb (ATL-HPA063634) Datasheet (External Link)
Vendor Page Anti GGA2 pAb (ATL-HPA063634)