Anti GGA2 pAb (ATL-HPA043313)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043313-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GGA2
Alternative Gene Name: KIAA1080, VEAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030872: 60%, ENSRNOG00000053118: 64%
Entrez Gene ID: 23062
Uniprot ID: Q9UJY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLIDLEVDNGPAQMGTVVPSLLHQDLAALGISDAPV |
Gene Sequence | ANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLIDLEVDNGPAQMGTVVPSLLHQDLAALGISDAPV |
Gene ID - Mouse | ENSMUSG00000030872 |
Gene ID - Rat | ENSRNOG00000053118 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GGA2 pAb (ATL-HPA043313) | |
Datasheet | Anti GGA2 pAb (ATL-HPA043313) Datasheet (External Link) |
Vendor Page | Anti GGA2 pAb (ATL-HPA043313) at Atlas Antibodies |
Documents & Links for Anti GGA2 pAb (ATL-HPA043313) | |
Datasheet | Anti GGA2 pAb (ATL-HPA043313) Datasheet (External Link) |
Vendor Page | Anti GGA2 pAb (ATL-HPA043313) |