Anti GGA2 pAb (ATL-HPA043313)

Atlas Antibodies

SKU: ATL-HPA043313-25

• 
• 

Protein Description: golgi-associated, gamma adaptin ear containing, ARF binding protein 2
Gene Name: GGA2
Alternative Gene Name: KIAA1080, VEAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030872: 60%, ENSRNOG00000053118: 64%
Entrez Gene ID: 23062
Uniprot ID: Q9UJY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLIDLEVDNGPAQMGTVVPSLLHQDLAALGISDAPV
• Gene Sequence: ANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLIDLEVDNGPAQMGTVVPSLLHQDLAALGISDAPV
• Gene ID - Mouse: ENSMUSG00000030872
• Gene ID - Rat: ENSRNOG00000053118
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.