Anti GGA2 pAb (ATL-HPA043313)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043313-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GGA2
Alternative Gene Name: KIAA1080, VEAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030872: 60%, ENSRNOG00000053118: 64%
Entrez Gene ID: 23062
Uniprot ID: Q9UJY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLIDLEVDNGPAQMGTVVPSLLHQDLAALGISDAPV |
| Gene Sequence | ANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLIDLEVDNGPAQMGTVVPSLLHQDLAALGISDAPV |
| Gene ID - Mouse | ENSMUSG00000030872 |
| Gene ID - Rat | ENSRNOG00000053118 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GGA2 pAb (ATL-HPA043313) | |
| Datasheet | Anti GGA2 pAb (ATL-HPA043313) Datasheet (External Link) |
| Vendor Page | Anti GGA2 pAb (ATL-HPA043313) at Atlas Antibodies |
| Documents & Links for Anti GGA2 pAb (ATL-HPA043313) | |
| Datasheet | Anti GGA2 pAb (ATL-HPA043313) Datasheet (External Link) |
| Vendor Page | Anti GGA2 pAb (ATL-HPA043313) |