Anti GGA1 pAb (ATL-HPA048280)

Atlas Antibodies

SKU: ATL-HPA048280-100

• 
• 
• 

Protein Description: golgi-associated, gamma adaptin ear containing, ARF binding protein 1
Gene Name: GGA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033128: 83%, ENSRNOG00000008897: 84%
Entrez Gene ID: 26088
Uniprot ID: Q9UJY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSS
• Gene Sequence: PSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSS
• Gene ID - Mouse: ENSMUSG00000033128
• Gene ID - Rat: ENSRNOG00000008897
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.