Anti GGA1 pAb (ATL-HPA048280)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048280-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: GGA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033128: 83%, ENSRNOG00000008897: 84%
Entrez Gene ID: 26088
Uniprot ID: Q9UJY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSS |
| Gene Sequence | PSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSS |
| Gene ID - Mouse | ENSMUSG00000033128 |
| Gene ID - Rat | ENSRNOG00000008897 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GGA1 pAb (ATL-HPA048280) | |
| Datasheet | Anti GGA1 pAb (ATL-HPA048280) Datasheet (External Link) |
| Vendor Page | Anti GGA1 pAb (ATL-HPA048280) at Atlas Antibodies |
| Documents & Links for Anti GGA1 pAb (ATL-HPA048280) | |
| Datasheet | Anti GGA1 pAb (ATL-HPA048280) Datasheet (External Link) |
| Vendor Page | Anti GGA1 pAb (ATL-HPA048280) |