Anti GFRA1 pAb (ATL-HPA043829)

Atlas Antibodies

Catalog No.: ATL-HPA043829-25

Protein Description: GDNF family receptor alpha 1
Gene Name: GFRA1
Alternative Gene Name: GDNFR, GDNFRA, GFR-ALPHA-1, RET1L, RETL1, TRNR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025089: 98%, ENSRNOG00000017438: 96%
Entrez Gene ID: 2674
Uniprot ID: P56159
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK
• Gene Sequence: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK
• Gene ID - Mouse: ENSMUSG00000025089
• Gene ID - Rat: ENSRNOG00000017438
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.