Anti GFOD2 pAb (ATL-HPA041112)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041112-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GFOD2
Alternative Gene Name: FLJ23802, MGC11335
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013150: 97%, ENSRNOG00000017953: 97%
Entrez Gene ID: 81577
Uniprot ID: Q3B7J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQ |
| Gene Sequence | VGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQ |
| Gene ID - Mouse | ENSMUSG00000013150 |
| Gene ID - Rat | ENSRNOG00000017953 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GFOD2 pAb (ATL-HPA041112) | |
| Datasheet | Anti GFOD2 pAb (ATL-HPA041112) Datasheet (External Link) |
| Vendor Page | Anti GFOD2 pAb (ATL-HPA041112) at Atlas Antibodies |
| Documents & Links for Anti GFOD2 pAb (ATL-HPA041112) | |
| Datasheet | Anti GFOD2 pAb (ATL-HPA041112) Datasheet (External Link) |
| Vendor Page | Anti GFOD2 pAb (ATL-HPA041112) |