Anti GFOD2 pAb (ATL-HPA041112)

Atlas Antibodies

SKU: ATL-HPA041112-25

• 
• 

Protein Description: glucose-fructose oxidoreductase domain containing 2
Gene Name: GFOD2
Alternative Gene Name: FLJ23802, MGC11335
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013150: 97%, ENSRNOG00000017953: 97%
Entrez Gene ID: 81577
Uniprot ID: Q3B7J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQ
• Gene Sequence: VGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQ
• Gene ID - Mouse: ENSMUSG00000013150
• Gene ID - Rat: ENSRNOG00000017953
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.