Anti GFOD2 pAb (ATL-HPA040939)
Atlas Antibodies
- SKU:
- ATL-HPA040939-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GFOD2
Alternative Gene Name: FLJ23802, MGC11335
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013150: 89%, ENSRNOG00000017953: 91%
Entrez Gene ID: 81577
Uniprot ID: Q3B7J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL |
Gene Sequence | PVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL |
Gene ID - Mouse | ENSMUSG00000013150 |
Gene ID - Rat | ENSRNOG00000017953 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GFOD2 pAb (ATL-HPA040939) | |
Datasheet | Anti GFOD2 pAb (ATL-HPA040939) Datasheet (External Link) |
Vendor Page | Anti GFOD2 pAb (ATL-HPA040939) at Atlas Antibodies |
Documents & Links for Anti GFOD2 pAb (ATL-HPA040939) | |
Datasheet | Anti GFOD2 pAb (ATL-HPA040939) Datasheet (External Link) |
Vendor Page | Anti GFOD2 pAb (ATL-HPA040939) |