Anti GFM2 pAb (ATL-HPA036863)

Atlas Antibodies

Catalog No.:
ATL-HPA036863-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: G elongation factor, mitochondrial 2
Gene Name: GFM2
Alternative Gene Name: EFG2, FLJ21661
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021666: 89%, ENSRNOG00000025285: 91%
Entrez Gene ID: 84340
Uniprot ID: Q969S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAEIMGYST
Gene Sequence TSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAEIMGYST
Gene ID - Mouse ENSMUSG00000021666
Gene ID - Rat ENSRNOG00000025285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GFM2 pAb (ATL-HPA036863)
Datasheet Anti GFM2 pAb (ATL-HPA036863) Datasheet (External Link)
Vendor Page Anti GFM2 pAb (ATL-HPA036863) at Atlas Antibodies

Documents & Links for Anti GFM2 pAb (ATL-HPA036863)
Datasheet Anti GFM2 pAb (ATL-HPA036863) Datasheet (External Link)
Vendor Page Anti GFM2 pAb (ATL-HPA036863)