Anti GFM1 pAb (ATL-HPA034765 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA034765-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: G elongation factor, mitochondrial 1
Gene Name: GFM1
Alternative Gene Name: EFGM, EGF1, GFM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027774: 96%, ENSRNOG00000012873: 96%
Entrez Gene ID: 85476
Uniprot ID: Q96RP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGE
Gene Sequence QYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGE
Gene ID - Mouse ENSMUSG00000027774
Gene ID - Rat ENSRNOG00000012873
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GFM1 pAb (ATL-HPA034765 w/enhanced validation)
Datasheet Anti GFM1 pAb (ATL-HPA034765 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GFM1 pAb (ATL-HPA034765 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GFM1 pAb (ATL-HPA034765 w/enhanced validation)
Datasheet Anti GFM1 pAb (ATL-HPA034765 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GFM1 pAb (ATL-HPA034765 w/enhanced validation)
Citations for Anti GFM1 pAb (ATL-HPA034765 w/enhanced validation) – 1 Found
Nyfeler, Beat; Hoepfner, Dominic; Palestrant, Deborah; Kirby, Christina A; Whitehead, Lewis; Yu, Robert; Deng, Gejing; Caughlan, Ruth E; Woods, Angela L; Jones, Adriana K; Barnes, S Whitney; Walker, John R; Gaulis, Swann; Hauy, Ervan; Brachmann, Saskia M; Krastel, Philipp; Studer, Christian; Riedl, Ralph; Estoppey, David; Aust, Thomas; Movva, N Rao; Wang, Zuncai; Salcius, Michael; Michaud, Gregory A; McAllister, Gregory; Murphy, Leon O; Tallarico, John A; Wilson, Christopher J; Dean, Charles R. Identification of elongation factor G as the conserved cellular target of argyrin B. Plos One. 7(9):e42657.  PubMed