Anti GET4 pAb (ATL-HPA019765)

Atlas Antibodies

Catalog No.: ATL-HPA019765-25

Protein Description: golgi to ER traffic protein 4 homolog (S. cerevisiae)
Gene Name: GET4
Alternative Gene Name: C7orf20, CEE, CGI-20, H_NH1244M04.5, TRC35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025858: 93%, ENSRNOG00000001293: 93%
Entrez Gene ID: 51608
Uniprot ID: Q7L5D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD
• Gene Sequence: AVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD
• Gene ID - Mouse: ENSMUSG00000025858
• Gene ID - Rat: ENSRNOG00000001293
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.