Anti GEMIN7 pAb (ATL-HPA052075)

Atlas Antibodies

Catalog No.:
ATL-HPA052075-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: gem (nuclear organelle) associated protein 7
Gene Name: GEMIN7
Alternative Gene Name: FLJ13956
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044709: 75%, ENSRNOG00000049772: 78%
Entrez Gene ID: 79760
Uniprot ID: Q9H840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAM
Gene Sequence GPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAM
Gene ID - Mouse ENSMUSG00000044709
Gene ID - Rat ENSRNOG00000049772
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GEMIN7 pAb (ATL-HPA052075)
Datasheet Anti GEMIN7 pAb (ATL-HPA052075) Datasheet (External Link)
Vendor Page Anti GEMIN7 pAb (ATL-HPA052075) at Atlas Antibodies

Documents & Links for Anti GEMIN7 pAb (ATL-HPA052075)
Datasheet Anti GEMIN7 pAb (ATL-HPA052075) Datasheet (External Link)
Vendor Page Anti GEMIN7 pAb (ATL-HPA052075)