Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065699-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GEMIN4
Alternative Gene Name: DKFZP434B131, DKFZP434D174, HC56, HCAP1, HHRF-1, p97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049396: 84%, ENSRNOG00000055236: 82%
Entrez Gene ID: 50628
Uniprot ID: P57678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAM |
Gene Sequence | DLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAM |
Gene ID - Mouse | ENSMUSG00000049396 |
Gene ID - Rat | ENSRNOG00000055236 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) | |
Datasheet | Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) | |
Datasheet | Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) |
Citations for Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) – 1 Found |
Stewart, Lorna M; Gerner, Lisa; Rettel, Mandy; Stein, Frank; Burrows, James F; Mills, Ian G; Evergren, Emma. CaMKK2 facilitates Golgi-associated vesicle trafficking to sustain cancer cell proliferation. Cell Death & Disease. 2021;12(11):1040. PubMed |