Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA065699-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: gem (nuclear organelle) associated protein 4
Gene Name: GEMIN4
Alternative Gene Name: DKFZP434B131, DKFZP434D174, HC56, HCAP1, HHRF-1, p97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049396: 84%, ENSRNOG00000055236: 82%
Entrez Gene ID: 50628
Uniprot ID: P57678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAM
Gene Sequence DLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAM
Gene ID - Mouse ENSMUSG00000049396
Gene ID - Rat ENSRNOG00000055236
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation)
Datasheet Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation)
Datasheet Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation)
Citations for Anti GEMIN4 pAb (ATL-HPA065699 w/enhanced validation) – 1 Found
Stewart, Lorna M; Gerner, Lisa; Rettel, Mandy; Stein, Frank; Burrows, James F; Mills, Ian G; Evergren, Emma. CaMKK2 facilitates Golgi-associated vesicle trafficking to sustain cancer cell proliferation. Cell Death & Disease. 2021;12(11):1040.  PubMed