Anti GEMIN2 pAb (ATL-HPA057114)
Atlas Antibodies
- SKU:
- ATL-HPA057114-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GEMIN2
Alternative Gene Name: SIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060121: 98%, ENSRNOG00000004360: 98%
Entrez Gene ID: 8487
Uniprot ID: O14893
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
Gene Sequence | ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
Gene ID - Mouse | ENSMUSG00000060121 |
Gene ID - Rat | ENSRNOG00000004360 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GEMIN2 pAb (ATL-HPA057114) | |
Datasheet | Anti GEMIN2 pAb (ATL-HPA057114) Datasheet (External Link) |
Vendor Page | Anti GEMIN2 pAb (ATL-HPA057114) at Atlas Antibodies |
Documents & Links for Anti GEMIN2 pAb (ATL-HPA057114) | |
Datasheet | Anti GEMIN2 pAb (ATL-HPA057114) Datasheet (External Link) |
Vendor Page | Anti GEMIN2 pAb (ATL-HPA057114) |