Anti GEMIN2 pAb (ATL-HPA057114)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057114-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GEMIN2
Alternative Gene Name: SIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060121: 98%, ENSRNOG00000004360: 98%
Entrez Gene ID: 8487
Uniprot ID: O14893
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
| Gene Sequence | ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
| Gene ID - Mouse | ENSMUSG00000060121 |
| Gene ID - Rat | ENSRNOG00000004360 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GEMIN2 pAb (ATL-HPA057114) | |
| Datasheet | Anti GEMIN2 pAb (ATL-HPA057114) Datasheet (External Link) |
| Vendor Page | Anti GEMIN2 pAb (ATL-HPA057114) at Atlas Antibodies |
| Documents & Links for Anti GEMIN2 pAb (ATL-HPA057114) | |
| Datasheet | Anti GEMIN2 pAb (ATL-HPA057114) Datasheet (External Link) |
| Vendor Page | Anti GEMIN2 pAb (ATL-HPA057114) |