Anti GDPGP1 pAb (ATL-HPA059841)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059841-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GDPGP1
Alternative Gene Name: C15orf58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050973: 87%, ENSRNOG00000013987: 23%
Entrez Gene ID:
Uniprot ID: Q6ZNW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLLSLHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEQAPSEPLDPGGHLHLLQDLPAPGFLFYTRGPGPDLESLISRVCRATDYLTDHE |
| Gene Sequence | VLLSLHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEQAPSEPLDPGGHLHLLQDLPAPGFLFYTRGPGPDLESLISRVCRATDYLTDHE |
| Gene ID - Mouse | ENSMUSG00000050973 |
| Gene ID - Rat | ENSRNOG00000013987 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GDPGP1 pAb (ATL-HPA059841) | |
| Datasheet | Anti GDPGP1 pAb (ATL-HPA059841) Datasheet (External Link) |
| Vendor Page | Anti GDPGP1 pAb (ATL-HPA059841) at Atlas Antibodies |
| Documents & Links for Anti GDPGP1 pAb (ATL-HPA059841) | |
| Datasheet | Anti GDPGP1 pAb (ATL-HPA059841) Datasheet (External Link) |
| Vendor Page | Anti GDPGP1 pAb (ATL-HPA059841) |