Anti GDPGP1 pAb (ATL-HPA059841)

Atlas Antibodies

Catalog No.:
ATL-HPA059841-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: GDP-D-glucose phosphorylase 1
Gene Name: GDPGP1
Alternative Gene Name: C15orf58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050973: 87%, ENSRNOG00000013987: 23%
Entrez Gene ID:
Uniprot ID: Q6ZNW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLLSLHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEQAPSEPLDPGGHLHLLQDLPAPGFLFYTRGPGPDLESLISRVCRATDYLTDHE
Gene Sequence VLLSLHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEQAPSEPLDPGGHLHLLQDLPAPGFLFYTRGPGPDLESLISRVCRATDYLTDHE
Gene ID - Mouse ENSMUSG00000050973
Gene ID - Rat ENSRNOG00000013987
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GDPGP1 pAb (ATL-HPA059841)
Datasheet Anti GDPGP1 pAb (ATL-HPA059841) Datasheet (External Link)
Vendor Page Anti GDPGP1 pAb (ATL-HPA059841) at Atlas Antibodies

Documents & Links for Anti GDPGP1 pAb (ATL-HPA059841)
Datasheet Anti GDPGP1 pAb (ATL-HPA059841) Datasheet (External Link)
Vendor Page Anti GDPGP1 pAb (ATL-HPA059841)