Anti GDPD5 pAb (ATL-HPA066762)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066762-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GDPD5
Alternative Gene Name: GDE2, PP1665
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035314: 93%, ENSRNOG00000036859: 93%
Entrez Gene ID: 81544
Uniprot ID: Q8WTR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTAT |
Gene Sequence | LQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTAT |
Gene ID - Mouse | ENSMUSG00000035314 |
Gene ID - Rat | ENSRNOG00000036859 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GDPD5 pAb (ATL-HPA066762) | |
Datasheet | Anti GDPD5 pAb (ATL-HPA066762) Datasheet (External Link) |
Vendor Page | Anti GDPD5 pAb (ATL-HPA066762) at Atlas Antibodies |
Documents & Links for Anti GDPD5 pAb (ATL-HPA066762) | |
Datasheet | Anti GDPD5 pAb (ATL-HPA066762) Datasheet (External Link) |
Vendor Page | Anti GDPD5 pAb (ATL-HPA066762) |