Anti GDPD5 pAb (ATL-HPA066762)

Atlas Antibodies

SKU: ATL-HPA066762-25

• 

Protein Description: glycerophosphodiester phosphodiesterase domain containing 5
Gene Name: GDPD5
Alternative Gene Name: GDE2, PP1665
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035314: 93%, ENSRNOG00000036859: 93%
Entrez Gene ID: 81544
Uniprot ID: Q8WTR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTAT
• Gene Sequence: LQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTAT
• Gene ID - Mouse: ENSMUSG00000035314
• Gene ID - Rat: ENSRNOG00000036859
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.