Anti GDPD5 pAb (ATL-HPA066762)

Atlas Antibodies

Catalog No.:
ATL-HPA066762-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: glycerophosphodiester phosphodiesterase domain containing 5
Gene Name: GDPD5
Alternative Gene Name: GDE2, PP1665
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035314: 93%, ENSRNOG00000036859: 93%
Entrez Gene ID: 81544
Uniprot ID: Q8WTR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTAT
Gene Sequence LQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTAT
Gene ID - Mouse ENSMUSG00000035314
Gene ID - Rat ENSRNOG00000036859
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GDPD5 pAb (ATL-HPA066762)
Datasheet Anti GDPD5 pAb (ATL-HPA066762) Datasheet (External Link)
Vendor Page Anti GDPD5 pAb (ATL-HPA066762) at Atlas Antibodies

Documents & Links for Anti GDPD5 pAb (ATL-HPA066762)
Datasheet Anti GDPD5 pAb (ATL-HPA066762) Datasheet (External Link)
Vendor Page Anti GDPD5 pAb (ATL-HPA066762)