Anti GDPD3 pAb (ATL-HPA041470)

Atlas Antibodies

Catalog No.: ATL-HPA041470-25

Protein Description: glycerophosphodiester phosphodiesterase domain containing 3
Gene Name: GDPD3
Alternative Gene Name: MGC4171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030703: 87%, ENSRNOG00000019685: 85%
Entrez Gene ID: 79153
Uniprot ID: Q7L5L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVV
• Gene Sequence: LRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVV
• Gene ID - Mouse: ENSMUSG00000030703
• Gene ID - Rat: ENSRNOG00000019685
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GDPD3 pAb (ATL-HPA041470) – 1 Found

Baras, Alexander S; Gandhi, Nilay; Munari, Enrico; Faraj, Sheila; Shultz, Luciana; Marchionni, Luigi; Schoenberg, Mark; Hahn, Noah; Hoque, Mohammad Obaidul; Berman, David; Bivalacqua, Trinity J; Netto, George. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. Plos One. 10(7):e0131245.