Anti GDPD3 pAb (ATL-HPA041470)

Atlas Antibodies

Catalog No.:
ATL-HPA041470-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glycerophosphodiester phosphodiesterase domain containing 3
Gene Name: GDPD3
Alternative Gene Name: MGC4171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030703: 87%, ENSRNOG00000019685: 85%
Entrez Gene ID: 79153
Uniprot ID: Q7L5L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVV
Gene Sequence LRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVV
Gene ID - Mouse ENSMUSG00000030703
Gene ID - Rat ENSRNOG00000019685
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GDPD3 pAb (ATL-HPA041470)
Datasheet Anti GDPD3 pAb (ATL-HPA041470) Datasheet (External Link)
Vendor Page Anti GDPD3 pAb (ATL-HPA041470) at Atlas Antibodies

Documents & Links for Anti GDPD3 pAb (ATL-HPA041470)
Datasheet Anti GDPD3 pAb (ATL-HPA041470) Datasheet (External Link)
Vendor Page Anti GDPD3 pAb (ATL-HPA041470)
Citations for Anti GDPD3 pAb (ATL-HPA041470) – 1 Found
Baras, Alexander S; Gandhi, Nilay; Munari, Enrico; Faraj, Sheila; Shultz, Luciana; Marchionni, Luigi; Schoenberg, Mark; Hahn, Noah; Hoque, Mohammad Obaidul; Berman, David; Bivalacqua, Trinity J; Netto, George. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. Plos One. 10(7):e0131245.  PubMed