Anti GDPD3 pAb (ATL-HPA041470)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041470-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GDPD3
Alternative Gene Name: MGC4171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030703: 87%, ENSRNOG00000019685: 85%
Entrez Gene ID: 79153
Uniprot ID: Q7L5L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVV |
| Gene Sequence | LRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVV |
| Gene ID - Mouse | ENSMUSG00000030703 |
| Gene ID - Rat | ENSRNOG00000019685 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GDPD3 pAb (ATL-HPA041470) | |
| Datasheet | Anti GDPD3 pAb (ATL-HPA041470) Datasheet (External Link) |
| Vendor Page | Anti GDPD3 pAb (ATL-HPA041470) at Atlas Antibodies |
| Documents & Links for Anti GDPD3 pAb (ATL-HPA041470) | |
| Datasheet | Anti GDPD3 pAb (ATL-HPA041470) Datasheet (External Link) |
| Vendor Page | Anti GDPD3 pAb (ATL-HPA041470) |
| Citations for Anti GDPD3 pAb (ATL-HPA041470) – 1 Found |
| Baras, Alexander S; Gandhi, Nilay; Munari, Enrico; Faraj, Sheila; Shultz, Luciana; Marchionni, Luigi; Schoenberg, Mark; Hahn, Noah; Hoque, Mohammad Obaidul; Berman, David; Bivalacqua, Trinity J; Netto, George. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. Plos One. 10(7):e0131245. PubMed |