Anti GDPD3 pAb (ATL-HPA041148)

Atlas Antibodies

Catalog No.:
ATL-HPA041148-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: glycerophosphodiester phosphodiesterase domain containing 3
Gene Name: GDPD3
Alternative Gene Name: MGC4171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030703: 73%, ENSRNOG00000019685: 73%
Entrez Gene ID: 79153
Uniprot ID: Q7L5L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIW
Gene Sequence DLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIW
Gene ID - Mouse ENSMUSG00000030703
Gene ID - Rat ENSRNOG00000019685
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GDPD3 pAb (ATL-HPA041148)
Datasheet Anti GDPD3 pAb (ATL-HPA041148) Datasheet (External Link)
Vendor Page Anti GDPD3 pAb (ATL-HPA041148) at Atlas Antibodies

Documents & Links for Anti GDPD3 pAb (ATL-HPA041148)
Datasheet Anti GDPD3 pAb (ATL-HPA041148) Datasheet (External Link)
Vendor Page Anti GDPD3 pAb (ATL-HPA041148)
Citations for Anti GDPD3 pAb (ATL-HPA041148) – 1 Found
Kitakaze, Keisuke; Tsuboi, Kazuhito; Tsuda, Maho; Takenouchi, Yasuhiro; Ishimaru, Hironobu; Okamoto, Yasuo. Development of a selective fluorescence-based enzyme assay for glycerophosphodiesterase family members GDE4 and GDE7. Journal Of Lipid Research. 62( 34673020):100141.  PubMed