Anti GDPD3 pAb (ATL-HPA041148)

Atlas Antibodies

Catalog No.: ATL-HPA041148-25

Protein Description: glycerophosphodiester phosphodiesterase domain containing 3
Gene Name: GDPD3
Alternative Gene Name: MGC4171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030703: 73%, ENSRNOG00000019685: 73%
Entrez Gene ID: 79153
Uniprot ID: Q7L5L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIW
• Gene Sequence: DLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIW
• Gene ID - Mouse: ENSMUSG00000030703
• Gene ID - Rat: ENSRNOG00000019685
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GDPD3 pAb (ATL-HPA041148) – 1 Found

Kitakaze, Keisuke; Tsuboi, Kazuhito; Tsuda, Maho; Takenouchi, Yasuhiro; Ishimaru, Hironobu; Okamoto, Yasuo. Development of a selective fluorescence-based enzyme assay for glycerophosphodiesterase family members GDE4 and GDE7. Journal Of Lipid Research. 62( 34673020):100141.