Anti GDNF pAb (ATL-HPA070283)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070283-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GDNF
Alternative Gene Name: ATF1, ATF2, HFB1-GDNF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022144: 90%, ENSRNOG00000012819: 90%
Entrez Gene ID: 2668
Uniprot ID: P39905
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRG |
| Gene Sequence | EDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRG |
| Gene ID - Mouse | ENSMUSG00000022144 |
| Gene ID - Rat | ENSRNOG00000012819 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GDNF pAb (ATL-HPA070283) | |
| Datasheet | Anti GDNF pAb (ATL-HPA070283) Datasheet (External Link) |
| Vendor Page | Anti GDNF pAb (ATL-HPA070283) at Atlas Antibodies |
| Documents & Links for Anti GDNF pAb (ATL-HPA070283) | |
| Datasheet | Anti GDNF pAb (ATL-HPA070283) Datasheet (External Link) |
| Vendor Page | Anti GDNF pAb (ATL-HPA070283) |