Anti GDNF pAb (ATL-HPA070283)

Atlas Antibodies

Catalog No.:
ATL-HPA070283-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glial cell derived neurotrophic factor
Gene Name: GDNF
Alternative Gene Name: ATF1, ATF2, HFB1-GDNF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022144: 90%, ENSRNOG00000012819: 90%
Entrez Gene ID: 2668
Uniprot ID: P39905
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRG
Gene Sequence EDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRG
Gene ID - Mouse ENSMUSG00000022144
Gene ID - Rat ENSRNOG00000012819
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GDNF pAb (ATL-HPA070283)
Datasheet Anti GDNF pAb (ATL-HPA070283) Datasheet (External Link)
Vendor Page Anti GDNF pAb (ATL-HPA070283) at Atlas Antibodies

Documents & Links for Anti GDNF pAb (ATL-HPA070283)
Datasheet Anti GDNF pAb (ATL-HPA070283) Datasheet (External Link)
Vendor Page Anti GDNF pAb (ATL-HPA070283)