Anti GDI1 pAb (ATL-HPA057668)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057668-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GDI1
Alternative Gene Name: FLJ41411, GDIL, MRX41, MRX48, OPHN2, RABGDIA, XAP-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015291: 100%, ENSRNOG00000056870: 100%
Entrez Gene ID: 2664
Uniprot ID: P31150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFK |
| Gene Sequence | RDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFK |
| Gene ID - Mouse | ENSMUSG00000015291 |
| Gene ID - Rat | ENSRNOG00000056870 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GDI1 pAb (ATL-HPA057668) | |
| Datasheet | Anti GDI1 pAb (ATL-HPA057668) Datasheet (External Link) |
| Vendor Page | Anti GDI1 pAb (ATL-HPA057668) at Atlas Antibodies |
| Documents & Links for Anti GDI1 pAb (ATL-HPA057668) | |
| Datasheet | Anti GDI1 pAb (ATL-HPA057668) Datasheet (External Link) |
| Vendor Page | Anti GDI1 pAb (ATL-HPA057668) |