Anti GDI1 pAb (ATL-HPA057668)

Atlas Antibodies

Catalog No.:
ATL-HPA057668-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: GDP dissociation inhibitor 1
Gene Name: GDI1
Alternative Gene Name: FLJ41411, GDIL, MRX41, MRX48, OPHN2, RABGDIA, XAP-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015291: 100%, ENSRNOG00000056870: 100%
Entrez Gene ID: 2664
Uniprot ID: P31150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFK
Gene Sequence RDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFK
Gene ID - Mouse ENSMUSG00000015291
Gene ID - Rat ENSRNOG00000056870
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GDI1 pAb (ATL-HPA057668)
Datasheet Anti GDI1 pAb (ATL-HPA057668) Datasheet (External Link)
Vendor Page Anti GDI1 pAb (ATL-HPA057668) at Atlas Antibodies

Documents & Links for Anti GDI1 pAb (ATL-HPA057668)
Datasheet Anti GDI1 pAb (ATL-HPA057668) Datasheet (External Link)
Vendor Page Anti GDI1 pAb (ATL-HPA057668)