Anti GDF6 pAb (ATL-HPA045206)

Atlas Antibodies

SKU:
ATL-HPA045206-25
  • Immunohistochemical staining of human stomach, lower shows strong membranous and cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line LHCN-M2 shows localization to nucleoplasm, nuclear membrane & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: growth differentiation factor 6
Gene Name: GDF6
Alternative Gene Name: BMP13, KFS, KFS1, SGM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051279: 91%, ENSRNOG00000007810: 91%
Entrez Gene ID: 392255
Uniprot ID: Q6KF10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IYRTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPPAGPLHVQLF
Gene Sequence IYRTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPPAGPLHVQLF
Gene ID - Mouse ENSMUSG00000051279
Gene ID - Rat ENSRNOG00000007810
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GDF6 pAb (ATL-HPA045206)
Datasheet Anti GDF6 pAb (ATL-HPA045206) Datasheet (External Link)
Vendor Page Anti GDF6 pAb (ATL-HPA045206) at Atlas Antibodies

Documents & Links for Anti GDF6 pAb (ATL-HPA045206)
Datasheet Anti GDF6 pAb (ATL-HPA045206) Datasheet (External Link)
Vendor Page Anti GDF6 pAb (ATL-HPA045206)