Anti GDF5OS pAb (ATL-HPA062720)

Atlas Antibodies

Catalog No.:
ATL-HPA062720-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: growth differentiation factor 5 opposite strand
Gene Name: GDF5OS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078972: 85%, ENSRNOG00000001304: 35%
Entrez Gene ID:
Uniprot ID: Q5U4N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSPSFSRALMSNTYLCFLTTGPRSSRENTQKSFPATSPRE
Gene Sequence SSPSFSRALMSNTYLCFLTTGPRSSRENTQKSFPATSPRE
Gene ID - Mouse ENSMUSG00000078972
Gene ID - Rat ENSRNOG00000001304
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GDF5OS pAb (ATL-HPA062720)
Datasheet Anti GDF5OS pAb (ATL-HPA062720) Datasheet (External Link)
Vendor Page Anti GDF5OS pAb (ATL-HPA062720) at Atlas Antibodies

Documents & Links for Anti GDF5OS pAb (ATL-HPA062720)
Datasheet Anti GDF5OS pAb (ATL-HPA062720) Datasheet (External Link)
Vendor Page Anti GDF5OS pAb (ATL-HPA062720)