Anti GDF3 pAb (ATL-HPA018468 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA018468-100
  • Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GDF3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402794).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: growth differentiation factor 3
Gene Name: GDF3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030117: 84%, ENSRNOG00000015331: 84%
Entrez Gene ID: 9573
Uniprot ID: Q9NR23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVV
Gene Sequence HKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVV
Gene ID - Mouse ENSMUSG00000030117
Gene ID - Rat ENSRNOG00000015331
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GDF3 pAb (ATL-HPA018468 w/enhanced validation)
Datasheet Anti GDF3 pAb (ATL-HPA018468 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GDF3 pAb (ATL-HPA018468 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GDF3 pAb (ATL-HPA018468 w/enhanced validation)
Datasheet Anti GDF3 pAb (ATL-HPA018468 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GDF3 pAb (ATL-HPA018468 w/enhanced validation)