Anti GDF11 pAb (ATL-HPA069609)

Atlas Antibodies

Catalog No.: ATL-HPA069609-25

Protein Description: growth differentiation factor 11
Gene Name: GDF11
Alternative Gene Name: BMP-11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025352: 100%, ENSRNOG00000007610: 100%
Entrez Gene ID: 10220
Uniprot ID: O95390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT
• Gene Sequence: DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT
• Gene ID - Mouse: ENSMUSG00000025352
• Gene ID - Rat: ENSRNOG00000007610
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.