Anti GDF11 pAb (ATL-HPA069609)

Atlas Antibodies

Catalog No.:
ATL-HPA069609-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: growth differentiation factor 11
Gene Name: GDF11
Alternative Gene Name: BMP-11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025352: 100%, ENSRNOG00000007610: 100%
Entrez Gene ID: 10220
Uniprot ID: O95390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT
Gene Sequence DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT
Gene ID - Mouse ENSMUSG00000025352
Gene ID - Rat ENSRNOG00000007610
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GDF11 pAb (ATL-HPA069609)
Datasheet Anti GDF11 pAb (ATL-HPA069609) Datasheet (External Link)
Vendor Page Anti GDF11 pAb (ATL-HPA069609) at Atlas Antibodies

Documents & Links for Anti GDF11 pAb (ATL-HPA069609)
Datasheet Anti GDF11 pAb (ATL-HPA069609) Datasheet (External Link)
Vendor Page Anti GDF11 pAb (ATL-HPA069609)