Anti GDF11 pAb (ATL-HPA060985)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060985-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GDF11
Alternative Gene Name: BMP-11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025352: 100%, ENSRNOG00000007610: 100%
Entrez Gene ID: 10220
Uniprot ID: O95390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DFQGDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMF |
| Gene Sequence | DFQGDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMF |
| Gene ID - Mouse | ENSMUSG00000025352 |
| Gene ID - Rat | ENSRNOG00000007610 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GDF11 pAb (ATL-HPA060985) | |
| Datasheet | Anti GDF11 pAb (ATL-HPA060985) Datasheet (External Link) |
| Vendor Page | Anti GDF11 pAb (ATL-HPA060985) at Atlas Antibodies |
| Documents & Links for Anti GDF11 pAb (ATL-HPA060985) | |
| Datasheet | Anti GDF11 pAb (ATL-HPA060985) Datasheet (External Link) |
| Vendor Page | Anti GDF11 pAb (ATL-HPA060985) |
| Citations for Anti GDF11 pAb (ATL-HPA060985) – 1 Found |
| Zhang, Yonghui; Wei, Yong; Liu, Dan; Liu, Feng; Li, Xiaoshan; Pan, Lianhong; Pang, Yi; Chen, Dilong. Role of growth differentiation factor 11 in development, physiology and disease. Oncotarget. 2017;8(46):81604-81616. PubMed |