Anti GDF10 pAb (ATL-HPA015498)

Atlas Antibodies

SKU: ATL-HPA015498-25

• 

Protein Description: growth differentiation factor 10
Gene Name: GDF10
Alternative Gene Name: BMP-3b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021943: 82%, ENSRNOG00000051993: 82%
Entrez Gene ID: 2662
Uniprot ID: P55107
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA
• Gene Sequence: ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA
• Gene ID - Mouse: ENSMUSG00000021943
• Gene ID - Rat: ENSRNOG00000051993
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GDF10 pAb (ATL-HPA015498) – 1 Found

Cerrato, Valentina; Parmigiani, Elena; Figueres-Oñate, María; Betizeau, Marion; Aprato, Jessica; Nanavaty, Ishira; Berchialla, Paola; Luzzati, Federico; de'Sperati, Claudio; López-Mascaraque, Laura; Buffo, Annalisa. Multiple origins and modularity in the spatiotemporal emergence of cerebellar astrocyte heterogeneity. Plos Biology. 2018;16(9):e2005513.