Anti GDF10 pAb (ATL-HPA015498)

Atlas Antibodies

Catalog No.:
ATL-HPA015498-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: growth differentiation factor 10
Gene Name: GDF10
Alternative Gene Name: BMP-3b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021943: 82%, ENSRNOG00000051993: 82%
Entrez Gene ID: 2662
Uniprot ID: P55107
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA
Gene Sequence ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA
Gene ID - Mouse ENSMUSG00000021943
Gene ID - Rat ENSRNOG00000051993
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GDF10 pAb (ATL-HPA015498)
Datasheet Anti GDF10 pAb (ATL-HPA015498) Datasheet (External Link)
Vendor Page Anti GDF10 pAb (ATL-HPA015498) at Atlas Antibodies

Documents & Links for Anti GDF10 pAb (ATL-HPA015498)
Datasheet Anti GDF10 pAb (ATL-HPA015498) Datasheet (External Link)
Vendor Page Anti GDF10 pAb (ATL-HPA015498)
Citations for Anti GDF10 pAb (ATL-HPA015498) – 1 Found
Cerrato, Valentina; Parmigiani, Elena; Figueres-Oñate, María; Betizeau, Marion; Aprato, Jessica; Nanavaty, Ishira; Berchialla, Paola; Luzzati, Federico; de'Sperati, Claudio; López-Mascaraque, Laura; Buffo, Annalisa. Multiple origins and modularity in the spatiotemporal emergence of cerebellar astrocyte heterogeneity. Plos Biology. 2018;16(9):e2005513.  PubMed