Anti GDF10 pAb (ATL-HPA015498)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015498-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GDF10
Alternative Gene Name: BMP-3b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021943: 82%, ENSRNOG00000051993: 82%
Entrez Gene ID: 2662
Uniprot ID: P55107
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA |
| Gene Sequence | ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEKTMQKA |
| Gene ID - Mouse | ENSMUSG00000021943 |
| Gene ID - Rat | ENSRNOG00000051993 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GDF10 pAb (ATL-HPA015498) | |
| Datasheet | Anti GDF10 pAb (ATL-HPA015498) Datasheet (External Link) |
| Vendor Page | Anti GDF10 pAb (ATL-HPA015498) at Atlas Antibodies |
| Documents & Links for Anti GDF10 pAb (ATL-HPA015498) | |
| Datasheet | Anti GDF10 pAb (ATL-HPA015498) Datasheet (External Link) |
| Vendor Page | Anti GDF10 pAb (ATL-HPA015498) |
| Citations for Anti GDF10 pAb (ATL-HPA015498) – 1 Found |
| Cerrato, Valentina; Parmigiani, Elena; Figueres-Oñate, María; Betizeau, Marion; Aprato, Jessica; Nanavaty, Ishira; Berchialla, Paola; Luzzati, Federico; de'Sperati, Claudio; López-Mascaraque, Laura; Buffo, Annalisa. Multiple origins and modularity in the spatiotemporal emergence of cerebellar astrocyte heterogeneity. Plos Biology. 2018;16(9):e2005513. PubMed |