Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014266-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GDAP1
Alternative Gene Name: CMT4, CMT4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025777: 93%, ENSRNOG00000005850: 97%
Entrez Gene ID: 54332
Uniprot ID: Q8TB36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYY |
| Gene Sequence | PLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYY |
| Gene ID - Mouse | ENSMUSG00000025777 |
| Gene ID - Rat | ENSRNOG00000005850 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) | |
| Datasheet | Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) | |
| Datasheet | Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) |
| Citations for Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) – 1 Found |
| Wolf, Christina; Pouya, Alireza; Bitar, Sara; Pfeiffer, Annika; Bueno, Diones; Rojas-Charry, Liliana; Arndt, Sabine; Gomez-Zepeda, David; Tenzer, Stefan; Bello, Federica Dal; Vianello, Caterina; Ritz, Sandra; Schwirz, Jonas; Dobrindt, Kristina; Peitz, Michael; Hanschmann, Eva-Maria; Mencke, Pauline; Boussaad, Ibrahim; Silies, Marion; Brüstle, Oliver; Giacomello, Marta; Krüger, Rejko; Methner, Axel. GDAP1 loss of function inhibits the mitochondrial pyruvate dehydrogenase complex by altering the actin cytoskeleton. Communications Biology. 2022;5(1):541. PubMed |