Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA014266-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/83096/151325/atl-hpa014266_anti-gdap1-pab-atl-hpa014266-wenhanced-validation_32954__46359.1681101081.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue")
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GDAP1
Alternative Gene Name: CMT4, CMT4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025777: 93%, ENSRNOG00000005850: 97%
Entrez Gene ID: 54332
Uniprot ID: Q8TB36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYY |
| Gene Sequence | PLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYY |
| Gene ID - Mouse | ENSMUSG00000025777 |
| Gene ID - Rat | ENSRNOG00000005850 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) | |
| Datasheet | Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) | |
| Datasheet | Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) |
| Citations for Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) – 1 Found |
| Wolf, Christina; Pouya, Alireza; Bitar, Sara; Pfeiffer, Annika; Bueno, Diones; Rojas-Charry, Liliana; Arndt, Sabine; Gomez-Zepeda, David; Tenzer, Stefan; Bello, Federica Dal; Vianello, Caterina; Ritz, Sandra; Schwirz, Jonas; Dobrindt, Kristina; Peitz, Michael; Hanschmann, Eva-Maria; Mencke, Pauline; Boussaad, Ibrahim; Silies, Marion; Brüstle, Oliver; Giacomello, Marta; Krüger, Rejko; Methner, Axel. GDAP1 loss of function inhibits the mitochondrial pyruvate dehydrogenase complex by altering the actin cytoskeleton. Communications Biology. 2022;5(1):541. PubMed |