Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA014266-25
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-GDAP1 antibody. Corresponding GDAP1 RNA-seq data are presented for the same tissues.
Immunofluorescent staining of human cell line A549 shows localization to cytosol & mitochondria.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ganglioside induced differentiation associated protein 1
Gene Name: GDAP1
Alternative Gene Name: CMT4, CMT4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025777: 93%, ENSRNOG00000005850: 97%
Entrez Gene ID: 54332
Uniprot ID: Q8TB36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYY
Gene Sequence PLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYY
Gene ID - Mouse ENSMUSG00000025777
Gene ID - Rat ENSRNOG00000005850
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation)
Datasheet Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation)
Datasheet Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation)
Citations for Anti GDAP1 pAb (ATL-HPA014266 w/enhanced validation) – 1 Found
Wolf, Christina; Pouya, Alireza; Bitar, Sara; Pfeiffer, Annika; Bueno, Diones; Rojas-Charry, Liliana; Arndt, Sabine; Gomez-Zepeda, David; Tenzer, Stefan; Bello, Federica Dal; Vianello, Caterina; Ritz, Sandra; Schwirz, Jonas; Dobrindt, Kristina; Peitz, Michael; Hanschmann, Eva-Maria; Mencke, Pauline; Boussaad, Ibrahim; Silies, Marion; Brüstle, Oliver; Giacomello, Marta; Krüger, Rejko; Methner, Axel. GDAP1 loss of function inhibits the mitochondrial pyruvate dehydrogenase complex by altering the actin cytoskeleton. Communications Biology. 2022;5(1):541.  PubMed
!