Anti GCSH pAb (ATL-HPA057079)

Atlas Antibodies

Catalog No.:
ATL-HPA057079-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: glycine cleavage system protein H
Gene Name: GCSH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034424: 93%, ENSRNOG00000011535: 95%
Entrez Gene ID: 2653
Uniprot ID: P23434
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Gene Sequence VNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Gene ID - Mouse ENSMUSG00000034424
Gene ID - Rat ENSRNOG00000011535
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCSH pAb (ATL-HPA057079)
Datasheet Anti GCSH pAb (ATL-HPA057079) Datasheet (External Link)
Vendor Page Anti GCSH pAb (ATL-HPA057079) at Atlas Antibodies

Documents & Links for Anti GCSH pAb (ATL-HPA057079)
Datasheet Anti GCSH pAb (ATL-HPA057079) Datasheet (External Link)
Vendor Page Anti GCSH pAb (ATL-HPA057079)