Anti GCSH pAb (ATL-HPA041368)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041368-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GCSH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034424: 90%, ENSRNOG00000011535: 89%
Entrez Gene ID: 2653
Uniprot ID: P23434
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA |
Gene Sequence | TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA |
Gene ID - Mouse | ENSMUSG00000034424 |
Gene ID - Rat | ENSRNOG00000011535 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GCSH pAb (ATL-HPA041368) | |
Datasheet | Anti GCSH pAb (ATL-HPA041368) Datasheet (External Link) |
Vendor Page | Anti GCSH pAb (ATL-HPA041368) at Atlas Antibodies |
Documents & Links for Anti GCSH pAb (ATL-HPA041368) | |
Datasheet | Anti GCSH pAb (ATL-HPA041368) Datasheet (External Link) |
Vendor Page | Anti GCSH pAb (ATL-HPA041368) |