Anti GCSH pAb (ATL-HPA041368)

Atlas Antibodies

Catalog No.:
ATL-HPA041368-100
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules..
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: glycine cleavage system protein H
Gene Name: GCSH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034424: 90%, ENSRNOG00000011535: 89%
Entrez Gene ID: 2653
Uniprot ID: P23434
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA
Gene Sequence TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA
Gene ID - Mouse ENSMUSG00000034424
Gene ID - Rat ENSRNOG00000011535
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCSH pAb (ATL-HPA041368)
Datasheet Anti GCSH pAb (ATL-HPA041368) Datasheet (External Link)
Vendor Page Anti GCSH pAb (ATL-HPA041368) at Atlas Antibodies

Documents & Links for Anti GCSH pAb (ATL-HPA041368)
Datasheet Anti GCSH pAb (ATL-HPA041368) Datasheet (External Link)
Vendor Page Anti GCSH pAb (ATL-HPA041368)
!