Anti GCSH pAb (ATL-HPA041368)

Atlas Antibodies

SKU: ATL-HPA041368-100

• 
• 
• 

Protein Description: glycine cleavage system protein H
Gene Name: GCSH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034424: 90%, ENSRNOG00000011535: 89%
Entrez Gene ID: 2653
Uniprot ID: P23434
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA
• Gene Sequence: TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA
• Gene ID - Mouse: ENSMUSG00000034424
• Gene ID - Rat: ENSRNOG00000011535
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.