Anti GCSAML pAb (ATL-HPA027507)

Atlas Antibodies

SKU: ATL-HPA027507-25

• 

Protein Description: germinal center-associated, signaling and motility-like
Gene Name: GCSAML
Alternative Gene Name: C1orf150, FLJ44728
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031370: 30%, ENSRNOG00000017213: 30%
Entrez Gene ID: 148823
Uniprot ID: Q5JQS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEV
• Gene Sequence: MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEV
• Gene ID - Mouse: ENSMUSG00000031370
• Gene ID - Rat: ENSRNOG00000017213
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.