Anti GCSAML pAb (ATL-HPA027507)

Atlas Antibodies

Catalog No.:
ATL-HPA027507-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: germinal center-associated, signaling and motility-like
Gene Name: GCSAML
Alternative Gene Name: C1orf150, FLJ44728
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031370: 30%, ENSRNOG00000017213: 30%
Entrez Gene ID: 148823
Uniprot ID: Q5JQS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEV
Gene Sequence MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEV
Gene ID - Mouse ENSMUSG00000031370
Gene ID - Rat ENSRNOG00000017213
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCSAML pAb (ATL-HPA027507)
Datasheet Anti GCSAML pAb (ATL-HPA027507) Datasheet (External Link)
Vendor Page Anti GCSAML pAb (ATL-HPA027507) at Atlas Antibodies

Documents & Links for Anti GCSAML pAb (ATL-HPA027507)
Datasheet Anti GCSAML pAb (ATL-HPA027507) Datasheet (External Link)
Vendor Page Anti GCSAML pAb (ATL-HPA027507)