Anti GCNT7 pAb (ATL-HPA052617)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052617-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GCNT7
Alternative Gene Name: C20orf105, dJ1153D9.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074569: 48%, ENSRNOG00000021551: 55%
Entrez Gene ID: 140687
Uniprot ID: Q6ZNI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNREIIHYIRSKWSDKNITPGVIQPLHIKSKTSQSHLEFVPKGSIYAPPNNRFKDKPP |
| Gene Sequence | TNREIIHYIRSKWSDKNITPGVIQPLHIKSKTSQSHLEFVPKGSIYAPPNNRFKDKPP |
| Gene ID - Mouse | ENSMUSG00000074569 |
| Gene ID - Rat | ENSRNOG00000021551 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GCNT7 pAb (ATL-HPA052617) | |
| Datasheet | Anti GCNT7 pAb (ATL-HPA052617) Datasheet (External Link) |
| Vendor Page | Anti GCNT7 pAb (ATL-HPA052617) at Atlas Antibodies |
| Documents & Links for Anti GCNT7 pAb (ATL-HPA052617) | |
| Datasheet | Anti GCNT7 pAb (ATL-HPA052617) Datasheet (External Link) |
| Vendor Page | Anti GCNT7 pAb (ATL-HPA052617) |