Anti GCM1 pAb (ATL-HPA011343)
Atlas Antibodies
- SKU:
- ATL-HPA011343-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GCM1
Alternative Gene Name: GCMA, hGCMa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023333: 60%, ENSRNOG00000007932: 63%
Entrez Gene ID: 8521
Uniprot ID: Q9NP62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCP |
Gene Sequence | LGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCP |
Gene ID - Mouse | ENSMUSG00000023333 |
Gene ID - Rat | ENSRNOG00000007932 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GCM1 pAb (ATL-HPA011343) | |
Datasheet | Anti GCM1 pAb (ATL-HPA011343) Datasheet (External Link) |
Vendor Page | Anti GCM1 pAb (ATL-HPA011343) at Atlas Antibodies |
Documents & Links for Anti GCM1 pAb (ATL-HPA011343) | |
Datasheet | Anti GCM1 pAb (ATL-HPA011343) Datasheet (External Link) |
Vendor Page | Anti GCM1 pAb (ATL-HPA011343) |
Citations for Anti GCM1 pAb (ATL-HPA011343) – 2 Found |
Renaud, Stephen J; Chakraborty, Damayanti; Mason, Clifford W; Rumi, M A Karim; Vivian, Jay L; Soares, Michael J. OVO-like 1 regulates progenitor cell fate in human trophoblast development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(45):E6175-84. PubMed |
Hornbachner, Ruth; Lackner, Andreas; Papuchova, Henrieta; Haider, Sandra; Knöfler, Martin; Mechtler, Karl; Latos, Paulina A. MSX2 safeguards syncytiotrophoblast fate of human trophoblast stem cells. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(37) PubMed |