Anti GCM1 pAb (ATL-HPA011343)

Atlas Antibodies

SKU:
ATL-HPA011343-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glial cells missing homolog 1 (Drosophila)
Gene Name: GCM1
Alternative Gene Name: GCMA, hGCMa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023333: 60%, ENSRNOG00000007932: 63%
Entrez Gene ID: 8521
Uniprot ID: Q9NP62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCP
Gene Sequence LGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCP
Gene ID - Mouse ENSMUSG00000023333
Gene ID - Rat ENSRNOG00000007932
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GCM1 pAb (ATL-HPA011343)
Datasheet Anti GCM1 pAb (ATL-HPA011343) Datasheet (External Link)
Vendor Page Anti GCM1 pAb (ATL-HPA011343) at Atlas Antibodies

Documents & Links for Anti GCM1 pAb (ATL-HPA011343)
Datasheet Anti GCM1 pAb (ATL-HPA011343) Datasheet (External Link)
Vendor Page Anti GCM1 pAb (ATL-HPA011343)



Citations for Anti GCM1 pAb (ATL-HPA011343) – 2 Found
Renaud, Stephen J; Chakraborty, Damayanti; Mason, Clifford W; Rumi, M A Karim; Vivian, Jay L; Soares, Michael J. OVO-like 1 regulates progenitor cell fate in human trophoblast development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(45):E6175-84.  PubMed
Hornbachner, Ruth; Lackner, Andreas; Papuchova, Henrieta; Haider, Sandra; Knöfler, Martin; Mechtler, Karl; Latos, Paulina A. MSX2 safeguards syncytiotrophoblast fate of human trophoblast stem cells. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(37)  PubMed