Anti GCKR pAb (ATL-HPA064305)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064305-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GCKR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059434: 90%, ENSRNOG00000048874: 90%
Entrez Gene ID: 2646
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFERAHQVTYSQSPKIATLMKSVSTSL |
| Gene Sequence | EDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFERAHQVTYSQSPKIATLMKSVSTSL |
| Gene ID - Mouse | ENSMUSG00000059434 |
| Gene ID - Rat | ENSRNOG00000048874 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GCKR pAb (ATL-HPA064305) | |
| Datasheet | Anti GCKR pAb (ATL-HPA064305) Datasheet (External Link) |
| Vendor Page | Anti GCKR pAb (ATL-HPA064305) at Atlas Antibodies |
| Documents & Links for Anti GCKR pAb (ATL-HPA064305) | |
| Datasheet | Anti GCKR pAb (ATL-HPA064305) Datasheet (External Link) |
| Vendor Page | Anti GCKR pAb (ATL-HPA064305) |