Anti GCKR pAb (ATL-HPA064305)

Atlas Antibodies

Catalog No.:
ATL-HPA064305-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glucokinase (hexokinase 4) regulator
Gene Name: GCKR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059434: 90%, ENSRNOG00000048874: 90%
Entrez Gene ID: 2646
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFERAHQVTYSQSPKIATLMKSVSTSL
Gene Sequence EDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFERAHQVTYSQSPKIATLMKSVSTSL
Gene ID - Mouse ENSMUSG00000059434
Gene ID - Rat ENSRNOG00000048874
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCKR pAb (ATL-HPA064305)
Datasheet Anti GCKR pAb (ATL-HPA064305) Datasheet (External Link)
Vendor Page Anti GCKR pAb (ATL-HPA064305) at Atlas Antibodies

Documents & Links for Anti GCKR pAb (ATL-HPA064305)
Datasheet Anti GCKR pAb (ATL-HPA064305) Datasheet (External Link)
Vendor Page Anti GCKR pAb (ATL-HPA064305)