Anti GCG pAb (ATL-HPA036761 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036761-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: glucagon
Gene Name: GCG
Alternative Gene Name: GLP1, GLP2, GRPP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000394: 96%, ENSRNOG00000005498: 97%
Entrez Gene ID: 2641
Uniprot ID: P01275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQ
Gene Sequence ERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQ
Gene ID - Mouse ENSMUSG00000000394
Gene ID - Rat ENSRNOG00000005498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCG pAb (ATL-HPA036761 w/enhanced validation)
Datasheet Anti GCG pAb (ATL-HPA036761 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GCG pAb (ATL-HPA036761 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GCG pAb (ATL-HPA036761 w/enhanced validation)
Datasheet Anti GCG pAb (ATL-HPA036761 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GCG pAb (ATL-HPA036761 w/enhanced validation)