Anti GCC2 pAb (ATL-HPA035849)

Atlas Antibodies

SKU: ATL-HPA035849-25

• 
• 

Protein Description: GRIP and coiled-coil domain containing 2
Gene Name: GCC2
Alternative Gene Name: GCC185, KIAA0336
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107275: 61%, ENSRNOG00000000823: 56%
Entrez Gene ID: 9648
Uniprot ID: Q8IWJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QNISEANSQHYQKNINSLQEELLQLKAIHQEEVKELMCQIEASAKEHEAEINKLNELKENLVKQCEASEKNIQKKYECELENLRKATSNANQDNQICSIL
• Gene Sequence: QNISEANSQHYQKNINSLQEELLQLKAIHQEEVKELMCQIEASAKEHEAEINKLNELKENLVKQCEASEKNIQKKYECELENLRKATSNANQDNQICSIL
• Gene ID - Mouse: ENSMUSG00000107275
• Gene ID - Rat: ENSRNOG00000000823
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GCC2 pAb (ATL-HPA035849) – 3 Found

Wong, Mie; Munro, Sean. Membrane trafficking. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science (New York, N.y.). 2014;346(6209):1256898. 

Ishida, Morié; Bonifacino, Juan S. ARFRP1 functions upstream of ARL1 and ARL5 to coordinate recruitment of distinct tethering factors to the trans-Golgi network. The Journal Of Cell Biology. 2019;218(11):3681-3696. 

Ziltener, Pascal; Rebane, Aleksander A; Graham, Morven; Ernst, Andreas M; Rothman, James E. The golgin family exhibits a propensity to form condensates in living cells. Febs Letters. 2020;594(19):3086-3094.