Anti GCAT pAb (ATL-HPA063924)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA063924-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $447.00
    
         
                            Gene Name: GCAT
Alternative Gene Name: KBL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006378: 93%, ENSRNOG00000055408: 94%
Entrez Gene ID: 23464
Uniprot ID: O75600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ | 
| Gene Sequence | RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ | 
| Gene ID - Mouse | ENSMUSG00000006378 | 
| Gene ID - Rat | ENSRNOG00000055408 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti GCAT pAb (ATL-HPA063924) | |
| Datasheet | Anti GCAT pAb (ATL-HPA063924) Datasheet (External Link) | 
| Vendor Page | Anti GCAT pAb (ATL-HPA063924) at Atlas Antibodies | 
| Documents & Links for Anti GCAT pAb (ATL-HPA063924) | |
| Datasheet | Anti GCAT pAb (ATL-HPA063924) Datasheet (External Link) | 
| Vendor Page | Anti GCAT pAb (ATL-HPA063924) |