Anti GCAT pAb (ATL-HPA063924)

Atlas Antibodies

Catalog No.:
ATL-HPA063924-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glycine C-acetyltransferase
Gene Name: GCAT
Alternative Gene Name: KBL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006378: 93%, ENSRNOG00000055408: 94%
Entrez Gene ID: 23464
Uniprot ID: O75600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ
Gene Sequence RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ
Gene ID - Mouse ENSMUSG00000006378
Gene ID - Rat ENSRNOG00000055408
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GCAT pAb (ATL-HPA063924)
Datasheet Anti GCAT pAb (ATL-HPA063924) Datasheet (External Link)
Vendor Page Anti GCAT pAb (ATL-HPA063924) at Atlas Antibodies

Documents & Links for Anti GCAT pAb (ATL-HPA063924)
Datasheet Anti GCAT pAb (ATL-HPA063924) Datasheet (External Link)
Vendor Page Anti GCAT pAb (ATL-HPA063924)