Anti GCAT pAb (ATL-HPA020460)

Atlas Antibodies

SKU:
ATL-HPA020460-25
  • Immunohistochemical staining of human pancreas shows moderate ctyoplasmic positivity in with a granular pattern in exocrine and endocrine cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glycine C-acetyltransferase
Gene Name: GCAT
Alternative Gene Name: KBL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006378: 91%, ENSRNOG00000055408: 92%
Entrez Gene ID: 23464
Uniprot ID: O75600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGA
Gene Sequence CLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGA
Gene ID - Mouse ENSMUSG00000006378
Gene ID - Rat ENSRNOG00000055408
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GCAT pAb (ATL-HPA020460)
Datasheet Anti GCAT pAb (ATL-HPA020460) Datasheet (External Link)
Vendor Page Anti GCAT pAb (ATL-HPA020460) at Atlas Antibodies

Documents & Links for Anti GCAT pAb (ATL-HPA020460)
Datasheet Anti GCAT pAb (ATL-HPA020460) Datasheet (External Link)
Vendor Page Anti GCAT pAb (ATL-HPA020460)