Anti GBP7 pAb (ATL-HPA051245)

Atlas Antibodies

Catalog No.: ATL-HPA051245-25

Protein Description: guanylate binding protein 7
Gene Name: GBP7
Alternative Gene Name: FLJ38822, GBP4L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028268: 54%, ENSRNOG00000028768: 54%
Entrez Gene ID: 388646
Uniprot ID: Q8N8V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FQENIAQLKKKMERERENYMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAA
• Gene Sequence: FQENIAQLKKKMERERENYMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAA
• Gene ID - Mouse: ENSMUSG00000028268
• Gene ID - Rat: ENSRNOG00000028768
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.