Anti GBP7 pAb (ATL-HPA051245)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051245-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GBP7
Alternative Gene Name: FLJ38822, GBP4L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028268: 54%, ENSRNOG00000028768: 54%
Entrez Gene ID: 388646
Uniprot ID: Q8N8V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FQENIAQLKKKMERERENYMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAA |
Gene Sequence | FQENIAQLKKKMERERENYMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAA |
Gene ID - Mouse | ENSMUSG00000028268 |
Gene ID - Rat | ENSRNOG00000028768 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GBP7 pAb (ATL-HPA051245) | |
Datasheet | Anti GBP7 pAb (ATL-HPA051245) Datasheet (External Link) |
Vendor Page | Anti GBP7 pAb (ATL-HPA051245) at Atlas Antibodies |
Documents & Links for Anti GBP7 pAb (ATL-HPA051245) | |
Datasheet | Anti GBP7 pAb (ATL-HPA051245) Datasheet (External Link) |
Vendor Page | Anti GBP7 pAb (ATL-HPA051245) |