Anti GBP7 pAb (ATL-HPA051245)

Atlas Antibodies

Catalog No.:
ATL-HPA051245-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: guanylate binding protein 7
Gene Name: GBP7
Alternative Gene Name: FLJ38822, GBP4L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028268: 54%, ENSRNOG00000028768: 54%
Entrez Gene ID: 388646
Uniprot ID: Q8N8V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQENIAQLKKKMERERENYMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAA
Gene Sequence FQENIAQLKKKMERERENYMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAA
Gene ID - Mouse ENSMUSG00000028268
Gene ID - Rat ENSRNOG00000028768
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GBP7 pAb (ATL-HPA051245)
Datasheet Anti GBP7 pAb (ATL-HPA051245) Datasheet (External Link)
Vendor Page Anti GBP7 pAb (ATL-HPA051245) at Atlas Antibodies

Documents & Links for Anti GBP7 pAb (ATL-HPA051245)
Datasheet Anti GBP7 pAb (ATL-HPA051245) Datasheet (External Link)
Vendor Page Anti GBP7 pAb (ATL-HPA051245)