Anti GBGT1 pAb (ATL-HPA051298)

Atlas Antibodies

Catalog No.: ATL-HPA051298-25

Protein Description: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Gene Name: GBGT1
Alternative Gene Name: A3GALNT, FS, MGC44848, UDP-GalNAc
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026829: 78%, ENSRNOG00000039906: 46%
Entrez Gene ID: 26301
Uniprot ID: Q8N5D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLR
• Gene Sequence: HMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLR
• Gene ID - Mouse: ENSMUSG00000026829
• Gene ID - Rat: ENSRNOG00000039906
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.