Anti GBGT1 pAb (ATL-HPA051298)

Atlas Antibodies

Catalog No.:
ATL-HPA051298-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
Gene Name: GBGT1
Alternative Gene Name: A3GALNT, FS, MGC44848, UDP-GalNAc
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026829: 78%, ENSRNOG00000039906: 46%
Entrez Gene ID: 26301
Uniprot ID: Q8N5D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLR
Gene Sequence HMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLR
Gene ID - Mouse ENSMUSG00000026829
Gene ID - Rat ENSRNOG00000039906
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GBGT1 pAb (ATL-HPA051298)
Datasheet Anti GBGT1 pAb (ATL-HPA051298) Datasheet (External Link)
Vendor Page Anti GBGT1 pAb (ATL-HPA051298) at Atlas Antibodies

Documents & Links for Anti GBGT1 pAb (ATL-HPA051298)
Datasheet Anti GBGT1 pAb (ATL-HPA051298) Datasheet (External Link)
Vendor Page Anti GBGT1 pAb (ATL-HPA051298)