Anti GBF1 pAb (ATL-HPA037759)

Atlas Antibodies

Catalog No.: ATL-HPA037759-25

Protein Description: golgi brefeldin A resistant guanine nucleotide exchange factor 1
Gene Name: GBF1
Alternative Gene Name: ARF1GEF, KIAA0248
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025224: 96%, ENSRNOG00000026048: 98%
Entrez Gene ID: 8729
Uniprot ID: Q92538
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INQYSLTVGLDLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFK
• Gene Sequence: INQYSLTVGLDLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFK
• Gene ID - Mouse: ENSMUSG00000025224
• Gene ID - Rat: ENSRNOG00000026048
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.