Anti GBF1 pAb (ATL-HPA037759)

Atlas Antibodies

Catalog No.:
ATL-HPA037759-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: golgi brefeldin A resistant guanine nucleotide exchange factor 1
Gene Name: GBF1
Alternative Gene Name: ARF1GEF, KIAA0248
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025224: 96%, ENSRNOG00000026048: 98%
Entrez Gene ID: 8729
Uniprot ID: Q92538
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INQYSLTVGLDLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFK
Gene Sequence INQYSLTVGLDLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFK
Gene ID - Mouse ENSMUSG00000025224
Gene ID - Rat ENSRNOG00000026048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GBF1 pAb (ATL-HPA037759)
Datasheet Anti GBF1 pAb (ATL-HPA037759) Datasheet (External Link)
Vendor Page Anti GBF1 pAb (ATL-HPA037759) at Atlas Antibodies

Documents & Links for Anti GBF1 pAb (ATL-HPA037759)
Datasheet Anti GBF1 pAb (ATL-HPA037759) Datasheet (External Link)
Vendor Page Anti GBF1 pAb (ATL-HPA037759)