Anti GBAS pAb (ATL-HPA063084 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063084-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GBAS
Alternative Gene Name: NIPSNAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029432: 78%, ENSRNOG00000023919: 75%
Entrez Gene ID: 2631
Uniprot ID: O75323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CSLLPRLRTWTSSSNRSREDSWLKSLFVRKVD |
Gene Sequence | CSLLPRLRTWTSSSNRSREDSWLKSLFVRKVD |
Gene ID - Mouse | ENSMUSG00000029432 |
Gene ID - Rat | ENSRNOG00000023919 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GBAS pAb (ATL-HPA063084 w/enhanced validation) | |
Datasheet | Anti GBAS pAb (ATL-HPA063084 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GBAS pAb (ATL-HPA063084 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GBAS pAb (ATL-HPA063084 w/enhanced validation) | |
Datasheet | Anti GBAS pAb (ATL-HPA063084 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GBAS pAb (ATL-HPA063084 w/enhanced validation) |