Anti GBAS pAb (ATL-HPA063084 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA063084-25

• 
• 
• 

Protein Description: glioblastoma amplified sequence
Gene Name: GBAS
Alternative Gene Name: NIPSNAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029432: 78%, ENSRNOG00000023919: 75%
Entrez Gene ID: 2631
Uniprot ID: O75323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CSLLPRLRTWTSSSNRSREDSWLKSLFVRKVD
• Gene Sequence: CSLLPRLRTWTSSSNRSREDSWLKSLFVRKVD
• Gene ID - Mouse: ENSMUSG00000029432
• Gene ID - Rat: ENSRNOG00000023919
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.