Anti GATM pAb (ATL-HPA026077 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026077-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GATM
Alternative Gene Name: AGAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111138: 93%, ENSRNOG00000000168: 91%
Entrez Gene ID: 2628
Uniprot ID: P50440
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPD |
Gene Sequence | LGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPD |
Gene ID - Mouse | ENSMUSG00000111138 |
Gene ID - Rat | ENSRNOG00000000168 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GATM pAb (ATL-HPA026077 w/enhanced validation) | |
Datasheet | Anti GATM pAb (ATL-HPA026077 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GATM pAb (ATL-HPA026077 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GATM pAb (ATL-HPA026077 w/enhanced validation) | |
Datasheet | Anti GATM pAb (ATL-HPA026077 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GATM pAb (ATL-HPA026077 w/enhanced validation) |
Citations for Anti GATM pAb (ATL-HPA026077 w/enhanced validation) – 1 Found |
Ellery, Stacey J; Murthi, Padma; Gatta, Paul A Della; May, Anthony K; Davies-Tuck, Miranda L; Kowalski, Greg M; Callahan, Damien L; Bruce, Clinton R; Wallace, Euan M; Walker, David W; Dickinson, Hayley; Snow, Rod J. The Effects of Early-Onset Pre-Eclampsia on Placental Creatine Metabolism in the Third Trimester. International Journal Of Molecular Sciences. 2020;21(3) PubMed |