Anti GATM pAb (ATL-HPA026077 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA026077-25
  • Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA026077 antibody. Corresponding GATM RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line RH-30 shows localization to mitochondria.
  • Western blot analysis in human kidney tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glycine amidinotransferase (L-arginine:glycine amidinotransferase)
Gene Name: GATM
Alternative Gene Name: AGAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111138: 93%, ENSRNOG00000000168: 91%
Entrez Gene ID: 2628
Uniprot ID: P50440
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPD
Gene Sequence LGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPD
Gene ID - Mouse ENSMUSG00000111138
Gene ID - Rat ENSRNOG00000000168
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GATM pAb (ATL-HPA026077 w/enhanced validation)
Datasheet Anti GATM pAb (ATL-HPA026077 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GATM pAb (ATL-HPA026077 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GATM pAb (ATL-HPA026077 w/enhanced validation)
Datasheet Anti GATM pAb (ATL-HPA026077 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GATM pAb (ATL-HPA026077 w/enhanced validation)



Citations for Anti GATM pAb (ATL-HPA026077 w/enhanced validation) – 1 Found
Ellery, Stacey J; Murthi, Padma; Gatta, Paul A Della; May, Anthony K; Davies-Tuck, Miranda L; Kowalski, Greg M; Callahan, Damien L; Bruce, Clinton R; Wallace, Euan M; Walker, David W; Dickinson, Hayley; Snow, Rod J. The Effects of Early-Onset Pre-Eclampsia on Placental Creatine Metabolism in the Third Trimester. International Journal Of Molecular Sciences. 2020;21(3)  PubMed