Anti GATAD2A pAb (ATL-HPA006759 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA006759-25
  • Immunohistochemical staining of human colon, placenta, skeletal muscle and testis using Anti-GATAD2A antibody HPA006759 (A) shows similar protein distribution across tissues to independent antibody HPA024373 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GATA zinc finger domain containing 2A
Gene Name: GATAD2A
Alternative Gene Name: p66alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036180: 89%, ENSRNOG00000022173: 91%
Entrez Gene ID: 54815
Uniprot ID: Q86YP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP
Gene Sequence RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP
Gene ID - Mouse ENSMUSG00000036180
Gene ID - Rat ENSRNOG00000022173
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GATAD2A pAb (ATL-HPA006759 w/enhanced validation)
Datasheet Anti GATAD2A pAb (ATL-HPA006759 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GATAD2A pAb (ATL-HPA006759 w/enhanced validation)



Citations for Anti GATAD2A pAb (ATL-HPA006759 w/enhanced validation) – 1 Found
Nishibuchi, Gohei; Shibata, Yukimasa; Hayakawa, Tomohiro; Hayakawa, Noriyo; Ohtani, Yasuko; Sinmyozu, Kaori; Tagami, Hideaki; Nakayama, Jun-ichi. Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex. The Journal Of Biological Chemistry. 2014;289(42):28956-70.  PubMed