Anti GATAD2A pAb (ATL-HPA006759 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006759-25

Protein Description: GATA zinc finger domain containing 2A
Gene Name: GATAD2A
Alternative Gene Name: p66alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036180: 89%, ENSRNOG00000022173: 91%
Entrez Gene ID: 54815
Uniprot ID: Q86YP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP
• Gene Sequence: RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP
• Gene ID - Mouse: ENSMUSG00000036180
• Gene ID - Rat: ENSRNOG00000022173
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GATAD2A pAb (ATL-HPA006759 w/enhanced validation) – 1 Found

Nishibuchi, Gohei; Shibata, Yukimasa; Hayakawa, Tomohiro; Hayakawa, Noriyo; Ohtani, Yasuko; Sinmyozu, Kaori; Tagami, Hideaki; Nakayama, Jun-ichi. Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex. The Journal Of Biological Chemistry. 2014;289(42):28956-70.