Anti GATAD1 pAb (ATL-HPA072785)

Atlas Antibodies

Catalog No.:
ATL-HPA072785-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GATA zinc finger domain containing 1
Gene Name: GATAD1
Alternative Gene Name: FLJ22489, ODAG, RG083M05.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007415: 92%, ENSRNOG00000008613: 92%
Entrez Gene ID: 57798
Uniprot ID: Q8WUU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR
Gene Sequence MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR
Gene ID - Mouse ENSMUSG00000007415
Gene ID - Rat ENSRNOG00000008613
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GATAD1 pAb (ATL-HPA072785)
Datasheet Anti GATAD1 pAb (ATL-HPA072785) Datasheet (External Link)
Vendor Page Anti GATAD1 pAb (ATL-HPA072785) at Atlas Antibodies

Documents & Links for Anti GATAD1 pAb (ATL-HPA072785)
Datasheet Anti GATAD1 pAb (ATL-HPA072785) Datasheet (External Link)
Vendor Page Anti GATAD1 pAb (ATL-HPA072785)