Anti GATAD1 pAb (ATL-HPA072785)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072785-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GATAD1
Alternative Gene Name: FLJ22489, ODAG, RG083M05.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007415: 92%, ENSRNOG00000008613: 92%
Entrez Gene ID: 57798
Uniprot ID: Q8WUU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR |
| Gene Sequence | MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR |
| Gene ID - Mouse | ENSMUSG00000007415 |
| Gene ID - Rat | ENSRNOG00000008613 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GATAD1 pAb (ATL-HPA072785) | |
| Datasheet | Anti GATAD1 pAb (ATL-HPA072785) Datasheet (External Link) |
| Vendor Page | Anti GATAD1 pAb (ATL-HPA072785) at Atlas Antibodies |
| Documents & Links for Anti GATAD1 pAb (ATL-HPA072785) | |
| Datasheet | Anti GATAD1 pAb (ATL-HPA072785) Datasheet (External Link) |
| Vendor Page | Anti GATAD1 pAb (ATL-HPA072785) |