Anti GATAD1 pAb (ATL-HPA072785)
Atlas Antibodies
- SKU:
- ATL-HPA072785-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GATAD1
Alternative Gene Name: FLJ22489, ODAG, RG083M05.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007415: 92%, ENSRNOG00000008613: 92%
Entrez Gene ID: 57798
Uniprot ID: Q8WUU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR |
Gene Sequence | MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR |
Gene ID - Mouse | ENSMUSG00000007415 |
Gene ID - Rat | ENSRNOG00000008613 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GATAD1 pAb (ATL-HPA072785) | |
Datasheet | Anti GATAD1 pAb (ATL-HPA072785) Datasheet (External Link) |
Vendor Page | Anti GATAD1 pAb (ATL-HPA072785) at Atlas Antibodies |
Documents & Links for Anti GATAD1 pAb (ATL-HPA072785) | |
Datasheet | Anti GATAD1 pAb (ATL-HPA072785) Datasheet (External Link) |
Vendor Page | Anti GATAD1 pAb (ATL-HPA072785) |