Anti GATA6 pAb (ATL-HPA066629)

Atlas Antibodies

Catalog No.:
ATL-HPA066629-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: GATA binding protein 6
Gene Name: GATA6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005836: 74%, ENSRNOG00000023433: 76%
Entrez Gene ID: 2627
Uniprot ID: Q92908
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGE
Gene Sequence INKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGE
Gene ID - Mouse ENSMUSG00000005836
Gene ID - Rat ENSRNOG00000023433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GATA6 pAb (ATL-HPA066629)
Datasheet Anti GATA6 pAb (ATL-HPA066629) Datasheet (External Link)
Vendor Page Anti GATA6 pAb (ATL-HPA066629) at Atlas Antibodies

Documents & Links for Anti GATA6 pAb (ATL-HPA066629)
Datasheet Anti GATA6 pAb (ATL-HPA066629) Datasheet (External Link)
Vendor Page Anti GATA6 pAb (ATL-HPA066629)