Anti GATA6 pAb (ATL-HPA066629)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066629-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GATA6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005836: 74%, ENSRNOG00000023433: 76%
Entrez Gene ID: 2627
Uniprot ID: Q92908
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | INKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGE |
Gene Sequence | INKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGE |
Gene ID - Mouse | ENSMUSG00000005836 |
Gene ID - Rat | ENSRNOG00000023433 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GATA6 pAb (ATL-HPA066629) | |
Datasheet | Anti GATA6 pAb (ATL-HPA066629) Datasheet (External Link) |
Vendor Page | Anti GATA6 pAb (ATL-HPA066629) at Atlas Antibodies |
Documents & Links for Anti GATA6 pAb (ATL-HPA066629) | |
Datasheet | Anti GATA6 pAb (ATL-HPA066629) Datasheet (External Link) |
Vendor Page | Anti GATA6 pAb (ATL-HPA066629) |