Anti GATA5 pAb (ATL-HPA067583)

Atlas Antibodies

Catalog No.:
ATL-HPA067583-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GATA binding protein 5
Gene Name: GATA5
Alternative Gene Name: bB379O24.1, GATAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015627: 67%, ENSRNOG00000058983: 72%
Entrez Gene ID: 140628
Uniprot ID: Q9BWX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE
Gene Sequence GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE
Gene ID - Mouse ENSMUSG00000015627
Gene ID - Rat ENSRNOG00000058983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GATA5 pAb (ATL-HPA067583)
Datasheet Anti GATA5 pAb (ATL-HPA067583) Datasheet (External Link)
Vendor Page Anti GATA5 pAb (ATL-HPA067583) at Atlas Antibodies

Documents & Links for Anti GATA5 pAb (ATL-HPA067583)
Datasheet Anti GATA5 pAb (ATL-HPA067583) Datasheet (External Link)
Vendor Page Anti GATA5 pAb (ATL-HPA067583)