Anti GAS8 pAb (ATL-HPA041311)

Atlas Antibodies

Catalog No.:
ATL-HPA041311-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: growth arrest-specific 8
Gene Name: GAS8
Alternative Gene Name: GAS11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040220: 96%, ENSRNOG00000026964: 96%
Entrez Gene ID: 2622
Uniprot ID: O95995
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG
Gene Sequence VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG
Gene ID - Mouse ENSMUSG00000040220
Gene ID - Rat ENSRNOG00000026964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAS8 pAb (ATL-HPA041311)
Datasheet Anti GAS8 pAb (ATL-HPA041311) Datasheet (External Link)
Vendor Page Anti GAS8 pAb (ATL-HPA041311) at Atlas Antibodies

Documents & Links for Anti GAS8 pAb (ATL-HPA041311)
Datasheet Anti GAS8 pAb (ATL-HPA041311) Datasheet (External Link)
Vendor Page Anti GAS8 pAb (ATL-HPA041311)
Citations for Anti GAS8 pAb (ATL-HPA041311) – 9 Found
Wallmeier, Julia; Shiratori, Hidetaka; Dougherty, Gerard W; Edelbusch, Christine; Hjeij, Rim; Loges, Niki T; Menchen, Tabea; Olbrich, Heike; Pennekamp, Petra; Raidt, Johanna; Werner, Claudius; Minegishi, Katsura; Shinohara, Kyosuke; Asai, Yasuko; Takaoka, Katsuyoshi; Lee, Chanjae; Griese, Matthias; Memari, Yasin; Durbin, Richard; Kolb-Kokocinski, Anja; Sauer, Sascha; Wallingford, John B; Hamada, Hiroshi; Omran, Heymut. TTC25 Deficiency Results in Defects of the Outer Dynein Arm Docking Machinery and Primary Ciliary Dyskinesia with Left-Right Body Asymmetry Randomization. American Journal Of Human Genetics. 2016;99(2):460-9.  PubMed
Shoemark, Amelia; Frost, Emily; Dixon, Mellisa; Ollosson, Sarah; Kilpin, Kate; Patel, Mitali; Scully, Juliet; Rogers, Andrew V; Mitchison, Hannah M; Bush, Andrew; Hogg, Claire. Accuracy of Immunofluorescence in the Diagnosis of Primary Ciliary Dyskinesia. American Journal Of Respiratory And Critical Care Medicine. 2017;196(1):94-101.  PubMed
Coutton, Charles; Martinez, Guillaume; Kherraf, Zine-Eddine; Amiri-Yekta, Amir; Boguenet, Magalie; Saut, Antoine; He, Xiaojin; Zhang, Feng; Cristou-Kent, Marie; Escoffier, Jessica; Bidart, Marie; Satre, Véronique; Conne, Béatrice; Fourati Ben Mustapha, Selima; Halouani, Lazhar; Marrakchi, Ouafi; Makni, Mounir; Latrous, Habib; Kharouf, Mahmoud; Pernet-Gallay, Karin; Bonhivers, Mélanie; Hennebicq, Sylviane; Rives, Nathalie; Dulioust, Emmanuel; Touré, Aminata; Gourabi, Hamid; Cao, Yunxia; Zouari, Raoudha; Hosseini, Seyedeh Hanieh; Nef, Serge; Thierry-Mieg, Nicolas; Arnoult, Christophe; Ray, Pierre F. Bi-allelic Mutations in ARMC2 Lead to Severe Astheno-Teratozoospermia Due to Sperm Flagellum Malformations in Humans and Mice. American Journal Of Human Genetics. 2019;104(2):331-340.  PubMed
Wallmeier, Julia; Bracht, Diana; Alsaif, Hessa S; Dougherty, Gerard W; Olbrich, Heike; Cindric, Sandra; Dzietko, Mark; Heyer, Christoph; Teig, Norbert; Thiels, Charlotte; Faqeih, Eissa; Al-Hashim, Aqeela; Khan, Sameena; Mogarri, Ibrahim; Almannai, Mohammed; Al Otaibi, Wadha; Alkuraya, Fowzan S; Koerner-Rettberg, Cordula; Omran, Heymut. Mutations in TP73 cause impaired mucociliary clearance and lissencephaly. American Journal Of Human Genetics. 2021;108(7):1318-1329.  PubMed
Liu, Ying; Lei, Cheng; Wang, Rongchun; Yang, Danhui; Yang, Binyi; Xu, Yingjie; Lu, Chenyang; Wang, Lin; Ding, Shuizi; Guo, Ting; Liu, Shaokun; Luo, Hong. Case Report: Whole-Exome Sequencing-Based Copy Number Variation Analysis Identified a Novel DRC1 Homozygous Exon Deletion in a Patient With Primary Ciliary Dyskinesia. Frontiers In Genetics. 13( 35873463):940292.  PubMed
Olbrich, Heike; Cremers, Carolin; Loges, Niki T; Werner, Claudius; Nielsen, Kim G; Marthin, June K; Philipsen, Maria; Wallmeier, Julia; Pennekamp, Petra; Menchen, Tabea; Edelbusch, Christine; Dougherty, Gerard W; Schwartz, Oliver; Thiele, Holger; Altmüller, Janine; Rommelmann, Frank; Omran, Heymut. Loss-of-Function GAS8 Mutations Cause Primary Ciliary Dyskinesia and Disrupt the Nexin-Dynein Regulatory Complex. American Journal Of Human Genetics. 2015;97(4):546-54.  PubMed
Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)  PubMed
Cho, Jung Hoon; Li, Zipeng A; Zhu, Lifei; Muegge, Brian D; Roseman, Henry F; Lee, Eun Young; Utterback, Toby; Woodhams, Louis G; Bayly, Philip V; Hughes, Jing W. Islet primary cilia motility controls insulin secretion. Science Advances. 2022;8(38):eabq8486.  PubMed
Ignatenko, Olesia; Malinen, Satu; Rybas, Sofiia; Vihinen, Helena; Nikkanen, Joni; Kononov, Aleksander; Jokitalo, Eija S; Ince-Dunn, Gulayse; Suomalainen, Anu. Mitochondrial dysfunction compromises ciliary homeostasis in astrocytes. The Journal Of Cell Biology. 2023;222(1)  PubMed